TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F4JV39|F4JV39_ARATH RING/FYVE/PHD zinc finger superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g32670 PE=4 SV=1
MEISPAEDKLVGSGEAVTTEEVSDINNKAVDICRICQSPEEPDNPLRHPCACRGSLKYIHSDCLFLWLNRRKRNHCEICK
RSYSIVPVYSENAPERLPWHEFLMGLLMRALRFMNLILPWILMMPFNAYCFSFRPWGRESEFVNQTVFELSLRFPGLFYT
AQIVSSATEMVVQMETIRVLLRRHPEFLRRMIILENGLKDRDVTGIVLLLANHLQILCDWWHDQLLQLPFLHIFQRGPLA
LAFVPRNTPLHQFGAIRRVFSLLSDNTFAVLAINIYWSFFRVLLPFSIGRVVLVLLRCLPHGWIAENASEMAAGDMVIRS
VLLACLGGVFTMSRDTYLTSVRTFLPSVKDTFILSFKLGVLPWLLGCWLHFCTFPILGKTASHTVEVLSDYPLMADKHWL
MGTLYLVSALSCMELIQKIVQKRALWYLLDVAEPNYKVTKLHLGPILLAFALHGTMVVIVLHLPIKTISLISQSFFPLQF
GVYEDEFVFGLLVAYMCLVIFGPRWLANLIRPSIRPIVHKWVITISSLLKLSDFLLGEPRKHRANHNMRLRCLVFGIAEG
SMVSLHGSQSDTTCEKDTNEQRDKRFMVRIGVMLILASLSMFLVSTTFMALPILVGRAFFHSISFFMLSFGLKHDDLCAF
WIGFCILRGIYIITCFVYDHFITGRTDLLLNHVLMFIRNVLLFSIWISVIPGVLGLLIDLMIIIPSQVPLGESPVYNLLH
DWLIGVVVLHIWIFLTMLTRINCFATVAWREKLQRIRSVTINRLPFTWLIRDVIGSIIVSLLFTLCVPYVVVNSLFPILG
FSSAVNLTVQRFIWPAILALIPIWFSVKLIRDLILYLHKLEFDNRYKVGERLVDFTEDLE