TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F5YII1|F5YII1_TREPZ CvpA family protein OS=Treponema primitia (strain ATCC BAA-887 / DSM 12427 / ZAS-2) GN=cvpA PE=4 SV=1
MKLAIIDIVFIVLILIMVFRCALRGFVKEIMSMASLVLGFLTAVLFYKPGAAFVRTKILADMQVLPELIAFAALFAIVFF
AIKLLERIIYDIISRINLGGLDQALGFVLGLLEGLLLVCVILFIINIQPLFNPESLLVNSFFAKLLSSLVGELRLPVPDL
PEVLGV