TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6DIG5|F6DIG5_THETH PilO; competence protein PilO OS=Thermus thermophilus SG0.5JP17-16 GN=Ththe16_1391 PE=4 SV=1
MKAVLARLGQREWALLAMVLTALLGLLWYYLLIVPTRQEIATVRQEIDRLTIERNRGLQAQRALPELRATIAALQAQRLA
FLRALPREERLAEVLSEVLQDAEASGVVVRSFTRSRTSAPVPEVRAVNLALALEAPFPETYAYLRRLEDLSRFSTLSGLN
LSVQSQEANPTLATGLTLTVYVLAQGVEAETGGSTP