TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F6DIG6|F6DIG6_THETH PilW; competence protein PilW OS=Thermus thermophilus SG0.5JP17-16 GN=Ththe16_1392 PE=4 SV=1
MKNAWQRLKEAWANLPRSTKLLLAALLLVGGVALWYVGLYLPAQVAEAPTPAPSTQVIEAPPIPPLASQEEAKPQAEAPA
QEEDQAPASSQEEAQAPPPAPVARAEPPPPNPFVPLVVETPPPPPASASRPTPVPEGPAVRVQTPAPAPQAAPATRPIPG
TSGALPAPKILSPALSAPLPQARETPPRVAVPTALVEAPLPGPEEKGAEKAPTPASPLERLVAEKGLRLSGTLLGPVSVA
ILESKEGYLVVPAGSPIPGTEAVVRQVEEGSVTLALKEETLNLSLVQAGGGQ