TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F7X0P7|F7X0P7_SINMM Putative uncharacterized protein OS=Sinorhizobium meliloti (strain SM11) GN=SM11_chr0755 PE=4 SV=1
MPERSHGSVSPQMSGAGYFQRPFRANVVRIDLTMMMPGDLMLEAIALLAFVMALAAFLGGRRSAERLDREIESLKAEIAR
LAKEGMGEPGPDLATGRPSEAGVPSVAGTEATADGPWSRAREGAGTSHDESAAGRESGDGAIDGPVAPSAAAARAESLES
RIGGRWPVWVGGLALALGGYFLVQYSIEAGLLSPAVRLTLAAIFGLALGVAGEVIRRRDVPAIADRFRNAMIPGVLTAAG
AVTLFGVVYAAYGIYDFIGTGAAFVLLALVSLATVGLSLLHGQALAGLGLLASLLTPLFVSSGEPRPWVLFGFLAVAWLA
TLAASRLRRWSVVPTLANAGLGLWGLAYVALATPFEAPPVTFALLVMIAGVALIWPGRAERTAEPSGTTQIGAASEPGAW
ERLFTPPYLAISISAAIVATVLALLFISPAVDAARFPVSDFVVIVVALAAAGSLRPAAIYAALLAAFGAVAGTWSLTALS
GVLAYLDPSFAGSPPEIVVPGRTAMLTAMTLSALFILLGGFVLARRPAGDRQFAALWAGIAAVVPNALLAMSFVMTGSFA
FDLPHGLAAFAGGIFLLGLVEWLYRRSAGAGDADVDGGLPALGSFGLFVIGLHAWTDGLVTTLAIALLGAGYSFATRLRS
WPVLPWGTVAGAVVILARIAWEPTIVGPGNLGTTPVFNALLPGYGIPALLLVASAYLLQAWPDLRVRNLLQALASLFVLL
TLAILVRHAMNRGVLDSSVPTLGEQAIYTLLAIGASGIFMTLDGRSPSPVFRYGGMALGVLSMLSVLGAHLVGLNPYFSG
ELLGSLPFFDLLLIGYLLPAIGYFGLAWYARGRRPLPYVVALAVSGAILAFAWATLSVRRFWQGQNVADWKGFLQGETYT
YSVVWLVLGVLLLVAGSRLDAKSIRIASAVLVFVAVLKVFLVDMSNLEGFLRALSFIGLGAVLIGIGRFYQKILSGSAGN
AGEGARRA