TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F9FB82|F9FB82_FUSOF Uncharacterized protein OS=Fusarium oxysporum (strain Fo5176) GN=FOXB_03634 PE=4 SV=1
MAPGPGTITTPSLTTKLVCRVLLGLLANIACIVPLKNLYRNGEFAAVVFIANIEWSNLDTIINSLIWRNDDTSKWWNGEG
FCDLNAYYVNFTNALFGTCLLAIMRNLAQQVGLLRANALTVRERRRRNLVQALIMFPLPIVQVAWVWPLTTQRYAVATLA
GCSWIAWPSWPYMVFFVLAPITVALITSGYAILVYIRFRDIAETTRSAVNSSRSANQRAQRTKRRLYLMVLAILVPYLPL
VVTLAVLNMLKAFPLQPFDYDLIHNRVIPYPWSAVIFVPSNSVNFGYLNNCYIHILSAIPVVIFFGMTKDAMNSYRRGLL
RLGFGCLFPKLHEEYDPDRTIGGSSSGHSYLMGSTTSTASSISRKIRSLLSQRNMSTASSASLNPISLQSTDAAPVTHEY
ELGPRLGGLQVSQSPLREISYPPPTVSGFSEPLNPPLRNPFLFRTRFDMPAIPFPSLSSFRFNKKDKRPPLDRGLPLDSL
PSVVNNQLWEDSSATQPCSQTLVWADREITPTPGIFTTQSSLLVPMSSTYSVTTEPLQETYRR