TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0HQP0|G0HQP0_HALHT Putative uncharacterized protein OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) GN=HAH_1426 PE=4 SV=1
MGVTEPRIDPRIALAVAVLAVSTSAILVRWSAAAASVAAFYRVLLTTALLAPLALGRHRSAFGRLSRRDVLAAAATGVAL
AIHFAAWFESLAWTSVAASVTLVQCQPLFVAVGAWALLDERVTRGTTAGILVAIGGIVVMSVGELLGGGAIGPRPLYGNA
LALVGGVMAAGYVLAGRSLRQRFPLIPYVTVVYGVAAICLLGFVVVSGHPVTGYPPQEWSLFLAMAVGPGVFGHTVLNWA
LAHVESSMVSVSLLGEPVGSALLALLLLAEIPGPSTVAGGAVVLVGIGVVARSRAVGATPAD