TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G0VYY4|G0VYY4_PAEPO Uncharacterized protein OS=Paenibacillus polymyxa M1 GN=M1_3080 PE=4 SV=1
MQTIIETVQPYVNTIVTATAGVLTAFVLGGLNKLKTKVNVWLDARTTAAQREVIHKVAGEAFALAQTTFKDAGGIRKMQE
ALQYASLRLTEQGIVVSPTELQAAIEKAYLEYKARTKAILATEAQPNEKAAQAAAKEAVSGLAAKLNDFLAQATAEVANT
VPAQVQSEPGPISAPLEAVQMPVTTE