TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2JSZ9|G2JSZ9_LISMN Competence protein ComFA OS=Listeria monocytogenes J0161 GN=LMOG_02350 PE=4 SV=1
MDIFPGRLYQEREIESNEGLREVVAIESNKCFRCGNTDAQLFGKMCCALCKRENCIYCRNCIVMGRVNSCQKLYYQQAML
LPKTKEILLRWEGVLSAGQRKASNAVVINLKGKMDMLLWAVAGSGKTEMMFEGMDWALRQGFRICVASPRVDVCLELLPR
LKEAFPSMDIVCLYGDSKDNYQGEQFVIATTHQLIRFYETFQVIFIDEVDAFPYAKDPFLEYAVMKARAKEGSTIIITAT
PEKKWQEECIRGKRNFVKIPGRYHRKKLPVPRTCWIGPWKKNLAKGKISPKLIQWMNGVEKKDQPALIFFPEIDAMNKFA
NALENKGYIRPVTVHSADELRKEKVEWLRKGKIKLLLTTTILERGVTFTDVQVAVFGSEGRIFTEAALVQISGRAGRKIS
HPTGDVCFFHYGKTIEMKQAISHIQKMNQQGVIEGMLDD