TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2JTB4|G2JTB4_LISMN ComE operon protein 2 OS=Listeria monocytogenes J0161 GN=LMOG_00216 PE=3 SV=1
MQRIAWDQFFMAQSHLISSRSTCTRLMVGATIVRDKRIIAGGYNGSIAGGDHCAEHGCYVVDGHCIRTIHAEMNAILQCA
KFGATTDKAELYVTHFPCLACTKSIIQAGIKKVYFAKDYKNHPYALELFNIAGVELQKVEFDESVLQVNNWNGEKMHTLV
KEAAVEVNIDPEKAEQLYQSISEKLN