TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G2PR68|G2PR68_MURRD Uncharacterized protein OS=Muricauda ruestringensis (strain DSM 13258 / LMG 19739 / B1) GN=Murru_0193 PE=4 SV=1
MNIRIEAQARKVTTNFDYMYKVVPSESNFSWAQHMLDFYYLRRNTGNLDYGMKFEFQKQYLTLYDAPKAYTIDDPDELYR
IGVNGSASWKMAQQWYLNANVTSLFASDFKEAIDFSEIQYSGKIFLGIGFGPDTPYQKLKVGLGYGILRERPLLYPFFSY
AQSLSKKITLELGYPHSTLHYRINERHYLMSTGSFNGEYTNIHLPPNTPNNLPYGTVRLSQYAFDLNIGYHYKIQPQWNT
VIKIGYLIDNTATINDRHNNILYDLATDPSVYLSMGITYKIHN