TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8EB00|G8EB00_CITFR Putative colicin immunity protein OS=Citrobacter freundii PE=4 SV=1
MMNEHSIDTDNRKANNALYLFIIIGLIPLLCIFVVYYKTPDALLLRKIATSTENLPSITSSYNPLMTKVMDIYCKTAPFL
ALILYILTFKIRKLINNTDRNTVLRSCLLSPLVYAAIVYLFCFRNFELTTAGRPVRLMATNDATLLLFYIGLYSIIFFTT
YITLFTPVTAFKLLKKRQ