TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8LDF3|G8LDF3_ENTCL Uncharacterized protein OS=Enterobacter cloacae EcWSU1 GN=EcWSU1_01100 PE=4 SV=1
MREPNENASLFSGRNFDLTGDERIHFTLYRRQQIDIGLPVHAGRR