TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8WDN3|G8WDN3_KLEOK Uncharacterized protein OS=Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686) GN=KOX_20235 PE=4 SV=1
MILLALVGGAMLSMQAAINGRLGSQVGVFRSAFLTFAVGALITALLIFYFAPHQSTTLLDVPKWQLLGAFCGVPYIVIMV
VAVQRIGTATATVAVIFGQLAMSLLIDNFGWLGNDAIAFSAGRLGAIVCLGLALFFIYRSSAAAKAEDKES