TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G9YAK2|G9YAK2_HAFAL Uncharacterized protein OS=Hafnia alvei ATCC 51873 GN=HMPREF0454_03626 PE=4 SV=1
MNKIALSVTGLVFAFSAGVAQAQQSEQRVVTIANCEQTTATQLSTMVKNDFLQNRLPRWADDKNLLGTSTPVVWVNQDQV
TQNGNDWQLLLTVRGTKIDKTYTVKVDCKAGKLEYSHPQ