TCDB is operated by the Saier Lab Bioinformatics Group
>GAM63666.1 hypothetical protein JCM19232_2646 [Vibrio ishigakensis]
MAETREFVPNFGWESIDMTSNFPTFVGESVNLKRHKRAIPAHRWEFEFTTPLLDVDQQRDFFAFISRLRGQLVPFEFIHP
VYSTPRGNMTNRTLTIAEAPQPGETQIIVEGFLSNEVNVVRSGDLIKIGTKVYQASIDADSDASGRALISLNSPLVALYA
IGDPVIGDNVPFLLSMTEDLVTVEMEGDNARMVQFTVTAVEDF