TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H0KCS9|H0KCS9_AGGAC Putative uncharacterized protein OS=Aggregatibacter actinomycetemcomitans RhAA1 GN=RHAA1_00814 PE=4 SV=1
MSFLSKTFGGLSKGYYIRQFLFGLLFFIFLIYIGYDHYNRSENYYILATNIVYGLVSLILYPYSRFTYEGIVEYIVGNNI
FITDVLFMMTVKLITMAICYFFALFISPIGLIWLYFYYSKQEKIANQSENQ