TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H1XVN5|H1XVN5_9BACT Putative uncharacterized protein OS=Caldithrix abyssi DSM 13497 GN=Calab_3331 PE=4 SV=1
MTRIKIFLILITILGVITAQEVEIKTFKIKYISASHIYLQGGEKDGLAVGDELIVYNGSEKIGRIKIEFVSRYSASASVL
EKQRDFKIGDIAKLVKEEKTAETAISSQKTDSLISERKMPPYQRKRTAPRALKTKIDGYVSGQYYYFKDLGARKLNFSQP
TMRLRLKIKNLWNRHYNFELRFRSRYNLRDKSFSANVPKSEWQNRLYEFTFDYNAPGAFLTYKLGRIISNAFSGVGYIDG
ALANLKLTNDFYFGLFAGTQPDWRTSNFQTEIQKYGGYLKFERGKFGSKKINVTLAGVGEYHGGTVSREFMYFQVSYYHG
RRWNIYHNVEIDVNRYWRKERAKESLSLTGFYLNANYRITSSISASLSYDNRKNYYTYELRTLADSLFDDAFRHGLRANV
YFKIFKDYQISLNFGLREKSTDANFSYSYGLNVTRRNFFSKYNRMSFRFSGFDNIFATGFSPNATFSRYLRGGHYLTFSY
GNYYYQIKNINDNKLNHWIRILGQIELPARFYINSTYEYDWGSDVKGHRLLFELGYRF