TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2AM49|H2AM49_KAZAF Uncharacterized protein OS=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) OX=1071382 GN=KAFR0A00110 PE=4 SV=1
MRSISLFCFAFFTVVALAAFPYYDYIHLGVTTIYAYFQDDKPIAVKVAWWGSFIQSTTNVIQTGIDACEACKDNHEDSAS
LDCARAVTNLAGTLATNLLSIYVGWHYAGTPNGSLEGADPTALRKRQLRQCESTNGLYDVSCVTDWLFDHYSQPESGKWY
PIDNSLTKRDLTQPSIYLKHNETSEVYHLIFNPSSGSTGTLAIAPARIVGNSTLAKRQDLPVYSPLCTGYIALDFCANQS
KWGGFYTSGELENELNEIFANDVSGSWRADYYKMYTCEDTCDTQDWEVSFRLYYASVGKFLHWTKCDTGS