TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H2ZTI8|H2ZTI8_LATCH Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=1
PSLRLKMRFQSACLLLPLGVVLLFLSSADAPCFSGTREECKDVDFIPGHNLGGEGIDITTLARKDAYIFKMETTLNTNNT
CTICKNMWMGRNEKLPLAIVDWRSIRKCKQSVTSKLYESSMSLASSSSNGVSNDWKVGLGFFPEPSTGVEVALSGSHSKV
VEYAMGKAKKDKYSFSSQEVFCRYYRAGGNLACLCTVADPTGDESKDCLGVEASVTAVSVKVSSAYKQCNKVKKKKLSQQ
KFSDKFSEREVEVTGGDLLFGGRQSVRFKSWIQSLKTNPDIISYSLAPLHLLARSQLRKNNLKQAITDYIMERAIKHKCP
RCPSGSFPSHREKCKCVCSANPYMTDSCCPKERGLGQLTVIIESAKNLWGDYPTQTDGYVKVLFQRIEQCTRDINENDNP
IWNARFDFGVVNILRDNNLKVQVWDRDNGYDDDELGSFTIPVRATKKFKDVTKFLKNGRLHLKFSFTCAPNLTGPDCSHH
S