TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H5RPX4|H5RPX4_9NOCA Membrane protein OS=Nocardia brasiliensis ATCC 700358 GN=O3I_10529 PE=4 SV=1
MGLPAVLLGVGVAAAEPVADKFGSFTTDDGWVVNVFKTDEKLDRWPNLAATAYTREGFYSVKGAVSIEGEGRAPVNAAAV
QIGLQLGCQIDVSTGLTAGLGLNVGVNGVVTVSQYPSGLVGGNAGVNPSVSGTLKPGGITQLVLGAKSLNGAYGSIATRE
AEMKVDACGGPVSVRSVVTVSLATPTSTDSFSVYGDPVYL