TCDB is operated by the Saier Lab Bioinformatics Group
>tr|H5UTD8|H5UTD8_9MICO Uncharacterized protein OS=Mobilicoccus pelagius NBRC 104925 GN=MOPEL_096_00030 PE=4 SV=1
MSTPGRFTSAATRTPTAPVGVSAREGRILTAWAMFQLVVLAVVFQAANLPVWGGIFTFVALAVFLLGQVGLSSRVARHRR
VHPRGFNGAARGAGIWAVLVVAVAGWFWIAQGPHASPWWATSFVALLAVAPSLILALRLTGAARTEDGRR