TCDB is operated by the Saier Lab Bioinformatics Group
>HAM56808.1 TPA: hypothetical protein DCQ64_15965 [Candidatus Rokubacteria bacterium]
MPLDSLRGDLQRIKDDDPLVLMRRWNRIAQSDNESLDKVASLDELYREMERYSIIRATRSQLLGRVMARGLKWQGADERR
VAFAEWQWGPQQRLLASAVRYVVEAYLRGFRLGEITWSARPIADGPHQGLDWIRRIKQIDVGNSTSGATSAVVVWEDAAG
QAWKVRCNVPDGTADPLTGSWPSKQREVKADAPEWQRLLFLTFPADSGRLRGEGALEACFPPWYSAIHFRQWKDSFAEKL
GSGVLIGRLGEGIDPARFAREKDALLTLMGNLKTHARIVLPPGWELDFKTMEAAAVGDFFDSCTAGANSDIXGDPHHVGH
VWRQGRGGDVRQQHDGIGHE