TCDB is operated by the Saier Lab Bioinformatics Group
>HBY62778.1 TPA: hypothetical protein DEH78_23385, partial [Solibacterales bacterium]
TPFNQTPASKISAQVMEELLAFVDNFDSARFNLADAIFRGSTYGYIEGERRVLSLYDGIPRFWWVPTAIRDLTKFRIRQV
PKLEGEGKNRSVRVDLELWSVAREDWEPLREENRRAIIQHLYNDTEERLGYGHGLVDQMYHYWRAKEIVLTENLAAVERF
AQGLLIAKIDSARLTETGNPNTAQVENFIAALEKHKARHILAVDKDDEVEMISPSGEGHQLFESMRNYLDNALRTLIIGA
NLTSSANEGGSYALADVQADSTQHLINYDRRILGQSLTRSLVKLVWDLNAENFRQLGLGDALPPRFTIVDEKIPDSKKEA
EITQILLAAGVKQKADEVYELCGRTQPGPGDEVIEPTPAPSPFGPPGTDFGAPFGQDKGAKGEPGESSESAFKRGVEAAA
AMYAAQFAGTKTTQAQPITVNVAPPSTTVQNYE