TCDB is operated by the Saier Lab Bioinformatics Group
>HCL55457.1 TPA: hypothetical protein DHW82_00390 [Spirochaetia bacterium]
MKDLYSRETAYNSYLNFFKSLPDPDKVLTERGLDISVYRDLSYDPHVEACMTSREAGVLQNEWIVEPVSNRGQNRKAVDF
ITEIFKNIDIERVFREILEAVYFGYAVLEKKYKRDGGSIVFEDIVGKPQEWFRFDTEGRLRFLSKSNMLEGEIVDMQKVE
LVRYRSSYRNPYGERKLARIFWTVAMKKGGMKWWLQFAEKYGSVFMYARVSGTTEDIDKKKYNTLQMLDDMVNSAVGVFG
VGDEIETLNFDRSGNAVFQDLIAFCNAEISKAILGQTLTTQTDGKTGTYAQAKVHQEVRKEILDADKKMVTAVMNRLIWD
ILSKNFNLSEYPVFTFYEEEDIENDRAERDTKLKQVGVSFTKQYFIENYNMKETDFEVSETPLFPENTPQFSESKKKTVI
L