TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3VY12|I3VY12_THESW Uncharacterized protein OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) GN=Tsac_2409 PE=4 SV=1
MLEGNTLAVLTLVIGVVIGVVATVGIALPYAKKKGIDIEKYLNEANDTVVKVDQVFDTIKPFLPQVPALGIIDKVLEYTK
LGVNKAEQLYHIGQIQADQRKAEAKSFILDALKLAKIDVTPELDKVIDGAIEASVMALGHTKEAAQAQVAATTDTQTPTT
QTTATANTQTTATTQQK