TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I3XGY5|I3XGY5_RHIFR Putative transmembrane protein OS=Sinorhizobium fredii USDA 257 GN=USDA257_p04260 PE=4 SV=1
MAGKDFGCDDPAATSEWQIELSAAQSRLTAKRRDSKKAENSDAQYAPDLERTATADDETESPSELTQDTHAQEPRRPFSL
ARRSEALFSRGSPLDLPASVFAGATALGFLSYITGIHNATYGRADGIVKQVGFLWAPNWTFVFMVLLPLFFAFAIELLVF
WKYEGRLKLVAQADRMESDDAWERNVEASSYTYWAVFFICVLFAGLFQWVGVCLLPLINGGGNYAVDWGKLALVRPEVIS
VPTSIVFTGLAYLYMCLCFYLFFAGLILLHTLVHDLWKIGEASKNWAGVDYPYEVNEVSLRVMRGIFRCTVLGILIAICM
KAQSSYLTSNGKNIVAWLVGDMFSAFQVRNNVSDGVRYRMPTHYSSLLIAISTCVVFLYGSIRLGVGRRCHFPLWRMSAV
VALLFASYLLIDVFAGFSILMGVGVLLAMYGLFDPGVGQWRASELGNNQSVS