TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I4EL39|I4EL39_9CHLR Uncharacterized protein OS=Nitrolancea hollandica Lb GN=NITHO_4920012 PE=4 SV=1
MADAFVQAAVALVPIILTVLVAAIRQRFKVEQIERVDRIAQASVYAVELISQSAGYDSRAKLAEAVRRARSLAASHGIQL
SDEQWQTLIEAAVSDLQAFRREIKRPAGE