TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I4L671|I4L671_9PSED Uncharacterized protein OS=Pseudomonas synxantha BG33R GN=PseBG33_4390 PE=4 SV=1
MNKSIKQCIPLPYLFIAMTMAPIFFIAFLFPAKATSAPYTNIESFINTYLLGVVGFWSSNFPFSSTVITNYIGLFGPIFA
VIFFLKVRKGMIIDADQYANMTISKYLFGLIVLSSFIYMIISVSYFYPHDLATHNLKWRLFGTHIFTYAIFSSGVLFIIY
FITLISYFSLLYIPRLLIKKNKQH