TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I6YB99|I6YB99_MYCTU Hemolysin TlyA family protein OS=Mycobacterium tuberculosis H37Rv GN=RVBD_1694 PE=4 SV=1
MARRARVDAELVRRGLARSRQQAAELIGAGKVRIDGLPAVKPATAVSDTTALTVVTDSERAWVSRGAHKLVGALEAFAIA
VAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISL
ATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYF
LWLRTQTDRALSAKGLEDAVHRAISEGP