TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I6YUR6|I6YUR6_MELRP Uncharacterized protein OS=Melioribacter roseus (strain P3M) GN=MROS_1073 PE=4 SV=1
MKKILLSVALIVLSTNNIFSQEVVNKGRISGYMFGDYYYNLSRDADIKGLSNVANGGEKDMNGIQLRRIYFTYDYDISET
FTTRFRLEADQSALTSNGKFGVFVKDAYLRWKDIFEGSDLIIGIQPTPAWEITETFWGRFLEKTIMDLRGIVSSRDLAIA
LKGKLDGYGIFKYWLMFGNGSGNSPEKDKYKRFYAHIQYSPIKQFTATLYADLKARPDINDPASTSNPPATIANNDLTYS
LFLGYKEKDAYSFGVEGFLNSRQNGMVNGTDVKDKNGMGISAFASYNISKELAVVGRYDYFDPNTDSSVKGDSRNWFIFS
LNYKPDEKVTISPNVIIETYESIPNGRSIDASITPRITFFYSFL