TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7IHE1|I7IHE1_BABMI Chromosome III, complete sequence OS=Babesia microti strain RI GN=BBM_III07290 PE=4 SV=1
MIGTRNRHMSFGTILDFTPLNSKQKSHLSRVYGTLGLSCLITAATVLYNLYMPQILAFILFTASFSYLFYLSSGKDLSGK
RLIALVLLSVSEGVMIKDIVRYAQVLNGEIVTSALAISMAIFFCFSLSSIFATQRLTYYFYSLVSSLMTLISIVSFANIF
MRSKIMLNATAIAALLMYAGFVAVDTQITLAEFDAGNRDFVVHAISLYVDIVAIFIRILQILIEKQHNECRKHDKDYD