TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7MB08|I7MB08_TETTS Transmembrane protein, putative OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00681830 PE=4 SV=2
MSSSELSSISSQSEMQSSSSSETSSQQGSKKEYIDKRKRKMNNKFSSANNKRIHQLRKSQSHNSDLLNIIPSSTTSIINS
QRKKSIKFNLSSNQEVNLGDENAFQQRINRGRRKSRFSKTDFLCEDVSPFKSLQMRKQNSQQLILKRKISDGDYPQSILK
KSSFERSKSMIESPANIIIDSNPSPKMLQNRRHNQIPSLEFIMNESNPQIFYNFNSPTNQILNRNNSQISTAIFPPQDSI
QNLNEKQNDYVKQPNILKNNNDLENNFFGDNYRQRPQRLSLENINQQIKLQLPNNLNISDISQQNNSNPSLNNFSNSNNA
HTPQSRNAYQLNSLQLNNSVQTPSSQRNSKNQNQIENINGNIGFSDLALQYTSNSTQAYSNPNLPNIITTQGNHHHRSPS
QQQIINKKKDYQEVLKELVDTQERLRAEEEKNEYLSLELKKNQEKNNALLRQQEILLKKSSFKQSVLREMNQKLNNMQNC
NKLVAIHVPFNQKIMSKINKMYTLIFYETIFLSQNALKRQPFFCQNSLQYVKNSIYIYNLLVINNLLSFIVAPTIFKQKT
NAKNIESYFYSAYDSSLISQIAFQIFITILVLTIAHLVNLSNMKRQYIRVKSKGKDKINLFKLVFNSFDFKESKSEQQVD
YFQEKYSSNLKQYIIKKIKINSADKSPKILIFLKYFLIFIYSGITFSALFVLKIILSLEYSEQIFYQGIVLSFMTIGMCE
LVSILYSKINDLQCLNLDKNNLKEICKIQSVSVLILSCYFVVSTLNIIFQKQDFSFLASIKTSFNFIQSDPNSKQHQNGF
QIECPEKIVSYIMIQYFVLLNAKILVKNVLRFSKNKLFHIFYQKQSYKKSQNFEFYENQHYDCLLFLLILINQSFFLWSS
LFGLLLFIVKFLINYAILRNSKVLNFSQYQSFQIQNRFNQDFTYVLIIFILYSFLLNSLSYQKFFDQNGQVCGPFQGNQN
ISSYIYENLFTQPLTQQIYQIITWPPLLWILLLSYLMRQWISNLSGSEWKSEKKNQGKMMKEVNKHYQQKLQNLEVKIKN
TKTILVSSQNFQINKNQ