TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J8IXD8|J8IXD8_BACCE Hemolysin TlyA family protein OS=Bacillus cereus VD078 GN=III_01305 PE=4 SV=1
MSVKKERVDVLLVERGLIETREKAKRAVMAGLVYANEMRLDKPGEKISQDTEITVKGQVMPYVSRGGYKLEKALETFQLD
LQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPADLERGLPQFASIDVSFIS
LRLILPVLKTMLMPNGDVAALIKPQFEAGREQVGKKGIVRDRKVHEAVVEMIVDFALKEGYNIEGLTFSPITGGDGNIEF
LIHLKWHGERENGENHSPVSIEQVVTEAHDVLKQKGKGE