TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9IRM2|J9IRM2_9SPIT MAC/Perforin domain containing protein OS=Oxytricha trifallax GN=OXYTRI_20266 PE=4 SV=1
MLSQNRIRFTKVGSVLDCTYRPSLFPLIALIAVNICTPVSSQDLFLKETAGRDLIANAGDLTFPNIDYLAAGYNIFLGDP
RSPHGIDPGFTNNFLFDFENQTLNGDKKYSIPHGVTVLSEFSCEASYSSQVSTSASEYQSSMKQTMGMSVEVSAMGGMGK
GAFTGSQSFSSSLDVMQNQNSVIITSDSTCTAYTAGVQEFNFPPQSKNLKTAVSLLSDVYEEEPYWRLIDSFGTHYIKDI
SMGSRFGYIYTMTYYSYQSIASQSSDQSFSVSVGVDAGIVAVSASVNYDTSQSSTQKTSISNQMTSTTQYSIGAKPPLNG
DVSAWMQQNFTNPMPAIYNIQPIDHLIEFYYNSTRPQVVQNVKRALQSYCVHLGIIGYPVKCDGIINLSRQNLAVNAVAL
QNRAHESGYYQASNAIDGQNFFCSNSMSWQGQSQSVATSEGSQAAYDSQYILLEFPEFYDVGDVLFYGRDQYQGKLKYLS
LRVGNSSNAAENVLCPGPSKSLDAGVGIYRCKGIIGKYLFIQNSAANNFPLGYCEIEVYSFKNGQKYRTIQGPNLLKGKS
AITSHLPAYQQYILWEPKKALDGWTCGEVNCQSMYISAQNIDTRNPYQWLNVDIVNATKIYIVKVYPRTSYTTQSQGISV
WVGNNTIPHKNKLCGRLTDYPFAFGGGSIKCDIVGRYVGFTSQLGVNGSDGYISLAEVEAYTDSLSNLISTDTAEVPQAP
NLLFNKSVNSSTVQPGSALNVASYAVDGSYNVLPAGGCFVGASLPTQYLNVNMNSTNYVEYVKVAGRLDSMTWISMADNY
QIYVGNSTNILENVACNGGQIYNGSQVIPCQITGQYVGLLRTQISGIEPQIMICEIQAFSY