TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J9P7D8|J9P7D8_CANLF Uncharacterized protein OS=Canis lupus familiaris GN=TMEM196 PE=4 SV=1
MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCGICGILCAKKKSGLVMILFSA
CCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIGIGGCTLSSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKR
LRAIEITDLPSCPVVPPTPELPTRK