TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K0AZ30|K0AZ30_CLOA9 Uncharacterized protein OS=Clostridium acidurici (strain ATCC 7906 / DSM 604 / KCTC 5404 / 9a) GN=Curi_c15100 PE=4 SV=1
MNLITENINSLALIATTTLVLFYLYKKGKKVLVKRVLRDLVTKAEEHYTNGQGKRKRQYVIKEFYKKAPILKIFLSEKEL
DSLIELAVEELKEKLN