TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K0DP05|K0DP05_9BURK Putative small multidrug resistance protein OS=Paraburkholderia phenoliruptrix BR3459a GN=BUPH_06523 PE=3 SV=1
MPFFFLFLSGTCSALASILLRLAGRVDNHALLFGISGRPALYRLAAIAAYGAGFLLYALALKRVELSVAYPLMVAVTILE
ILLFGVVSGEAMTLRTVLGAALLLASVLLLYLPAKAGP