TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K0I1V2|K0I1V2_9BURK Transmembrane protein OS=Acidovorax sp. KKS102 GN=C380_07250 PE=4 SV=1
MKTHRIASRSRQRGLSFFGLVFIGVIAVAVFAIGGQSVPIFLEYTSAKKAIEKAKVESTVPGVRAAFDRAAAIDDITSIR
GADLDVTKRGDKVVVSFKYSREIPLAGPAYLVYRFEAQTN