TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K0P0B6|K0P0B6_9BACT Uncharacterized protein OS=Cardinium endosymbiont cEper1 of Encarsia pergandiella GN=CAHE_0645 PE=4 SV=1
MMSTIGWGMLLIVLIASLYLGGISLGLLSGLVLGLLTCSVQPTPPPNDLMLLQATWLLLMATLEATGFFYLMANKCKIFA
GQVKNHNGISIVLFCYGLVFLTGDKAWLYRLACEPNPLHKGKSRLLFPIAVAGHMAVLASPLSISGILLIVVAGNNGLPI
LNLVGTTATLTIGITAASSWFAYLIPDRWLSKLYASFNDLAKDEVVAQPKNKIELLPCLLVVAELLFLGIEPKPNGSTQL
NSIQKIFPVKFPIFFALVMLSTAAVAMLWFKIKPAKILQSHRFKLGIQQLFIFLGLAWLVDSLLSHDKIYWIKMWWDGRI
HYGFYLVAALYMLLMDISIIIWLFSALLIERDGSILILALWLVIVHSLAPIRSWMSHMIKGYKNKE