TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K0RU20|K0RU20_THAOC Uncharacterized protein OS=Thalassiosira oceanica GN=THAOC_28343 PE=4 SV=1
MTRPRSTALDLARGRRTVTDDETTRDERQQHGHPRTPHATYAGHEGPQLHVECALVGRSPCVGSVGRTPRLRQLRPGILE
EVEAPVQLDKGSAEVAVREQAQSQQQLDESNEDEATAERGLGILVLLTVPLAWGTYTPAVKYMYEMEPAIPGFVFSAGYY
LVAAVTLRLLSSLQANESNELKVDRAEESEEGLDIRGGWELGSYLFVGNALQVVGLQTVPADRAAFLVQLTTVLVPLVAA
LSVGALSAVPAQTWLACVVAFVGVSVMGIDDGGVGAGISGGNPITLLHVSPGDLLIVLAAFSYTLHVVRLGVYAPRTKPL
ALASAKATTEAFLSVAVVIILTIIGNNALEVPQFMQETGQGVINYFDALKTAASDNPRLLEISACAILWTGWVTCAYTIY
AQSYGQSKVSPTESNLIYTTQPLFSSLFAYFLLGETLGAAGYVGATLICLALWLVSSPSNITETKTE