TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K2MW49|K2MW49_TRYCR Uncharacterized protein OS=Trypanosoma cruzi marinkellei GN=MOQ_000295 PE=4 SV=1
MLRRLNNCVTSRSLTMATGVGLSIAGRCFQQPRRSGLPAVKETTMMVAPTFFMSGRGFSVQPLRHMRGVKWVKPVTSPMN
FGGDNTGGGSTADSLTPYVRQHLSRVYGLLAAGTAVAGIGSFLMFSTPLGKAMPFWLPMVGGFVPLLWLSFAPPQDPNLK
LALFFSFTVLEGMALAPLVAITMAKGVLGTAIVLTGAVFFGFSAAALLAPRASLLAFQGPLFGMLMGMVAISILNLFYPT
AFAHSLILYGGLALFSLFVSVDTQAMIERARCGAGDHVQDALQMFLNVVNIFVRIAQILGSMDR