TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K3WB25|K3WB25_PYTUL Uncharacterized protein OS=Pythium ultimum DAOM BR144 GN=PYU1_G002164 PE=4 SV=1
MKSDFIGGTIAVLAALASIFGVNLQKYSHDKEELRAKPRPYHLRPIWWVGMICVVAASLGDFFALGFAPQTLVASLGGGS
TILGNCLMSRFWLKQSLYITDITGVALVTVGVVILAAASEEEDGHYKMDQIYKLMEAAPFLLYCFITTAFVMTLYLRVRR
SKAPALRVAANDKDEGKVEDLQMKKIELAAIAAKNKQDPEAQAKPEVDEQEDEHVSRSAMMSPFPSPIWGDTLHLSPMGR
IPGEEDDNDDIEHALSKLRSFSERKYEGEVEKHTLIIDPKLPLYWAAISGTIGAQSVLLAKCVAEMISSTISGDNQFTYF
GTYVLVGGMVATLLTQTHTLNMATMTGDTMSAYPVFQAFWISMSNISGVVFFQHAHSFTSAQWMMFPSAIGFVLVGIYLI
SKHQKFGNRVKYSVAMPISLSSPRQHDIVAQSFVFRVMTPQKLQEDDFVEDDHVDLQLSPRKAKRSVDVV