TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K3WTZ9|K3WTZ9_GLOUD Uncharacterized protein OS=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) OX=431595 PE=3 SV=1
MAFNTTDMRFLPVDYHSEVARELVEFFHTFYRFGAASNVFDLQDPVYAQFLHNVLFGSLVIGAVVFVALAIIVVRRCFLH
IRSAFVRKVSMESNSVEFSAVILMTIIAISSLSGLLGEAQVDYSVGVVHHAMTNASDRFGDAHKFAFESGVASEVIRNRA
DNMVVSFSESELPPEAFKLSVESLRLMHSSKELVNKTDTMLPKYYRDMADEWQFSYFMLKSSTNAAILSVALASFLLISS
VGWSMVTPLRISILVILSVVPVSHTLIGVYLSSTIMTSDFCAAPMNATVSLLHPNAAVSYYLECPKNVVSPLIAPASSVY
DDTKVVTSLQKELETYADKHGDVGKRMKTEFLDPIGKQIKAIDQFLVAFNGTQSCNETARSYQHAVSAYCEYGMLGFFSM
WVHQILLCIFLFIGVVTSVLVYERVHIREIRMDARYQMLSTYEDDNMEHVYLSSD