TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K4E118|K4E118_TRYCR Uncharacterized protein OS=Trypanosoma cruzi GN=TCSYLVIO_004718 PE=4 SV=1
MPHAKSGGNGSVTVGLKTSEGDTVSQQGREKELPLDTAKLVPYNGNADLPLYTIDQVPEHLCDNRYILTGYRVGYTARMC
ISSIIALHNETFNIWTHLVGFLAFLVVVVCFFMIVLIPSSHQQQHEGNAFSNAASESKGLTYFLFAAYSFGCLMCMLCST
VFHTLLPHKSRKVYSWAHSLDYFGITFLVVGSFLPFCYFSFACEPFWRWTYLSMISFFGVFGVLGPFFKEWTQQQYARSK
ILFYVCMVGSGLFPIVHIYLLLPGNVSSSFVEGLLLMMALYGVGVFVYAFQIPEFFFPGKFDIYLSSHQIWHVFVLAAAF
VHFFNTASIYVNFRQMNLSC