TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K4M9J6|K4M9J6_9EURY Uncharacterized protein OS=Methanolobus psychrophilus R15 GN=Mpsy_0616 PE=4 SV=1
MIPAETLAIIFGLTAALSWGAGDFVGGCATRRTSAYSVVLVTQIMGIITFPILAFAFSESLPPSNNLMWGAFAGFFGAAG
LIALYIGLAKGKMSIVAPLAAVISVVTPVIYSGLNEGIPSIIKITGFTFAFIGIWFIVSMSAGPGLKAKDLEYPLLAGVL
FGLFFISIDNFSATAIYWPLTASRITALIMLTGFMMLTKTLSKPTSDIIPVVILAGLFNTGGATLFALASEAGRLDVATV
LSSLSTAVTVLLACTLLKEQLAPRQWAGVMAALTAIILISI