TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K7VSJ1|K7VSJ1_9NOST Cell adhesion protein OS=Anabaena sp. 90 OX=46234 GN=sepJ PE=4 SV=1
MGRFEKRPENPRIRGELSRAAENALWDVVEDLENLQQNLLRSLQEDVKRLEIEKTRLSTDIQKLIEEKEQLQQSRQITEQ
QVLIRQLAEVLAKHISSQLQSSLKTLATQAVEYNPSDLVTLQNAQINNNTVNEIGQNVTNMLDSLDDNVTIAFNSLLQEL
KNYQGDLSQQLSRMYSQQQQGEAILAEFVNRLRSEVEKNRDANSLKVITGGPPTVLQLADSLRGEAITHQNGNGEKSSQK
IIVEPVTLIPHQSPQGDSTSAANAVILSSPTEKSPEPSSFVNPDLPAIPENQSPELSSFVNPDLPAIPENQSPELSSFVN
PDTSLEDKNSELSAVLTSKVLTAPTLGETKPEPVSVLTPNLSTGRPPTPKLRRETTSKQKTTPKQPATPQQPATPRQPET
PRQQRSRTSPNWSQLQIGFLLICLSTVVSSLYNVAIKAIFFTASNPLGGLPTQQLIFPTLGNIFLILMLRLLVVVPLMLL
LSPILHPPIWQELENLFASLRANATPVQNKTKQSLFLSVISGCLLFLSQVFIYIAIGEVTTGIAIALFFIYPVMSVFLSW
VLFQERPSLMVTGAMAAIFCGELLVLGSQSVGVNNTSLGSTTAILSGIAFAIYVILTRICATKLKLHPVSLTSINFTTML
LLSFICLIIPLPSNLGLAISSSNILELVLSAFILGVLTLCGYLFNNFGIRNLGTPVSSLIGATVPILTVIFAGVMLQESL
NIAQVIGVILVTVGAASISLKKTPNQLQPSE