TCDB is operated by the Saier Lab Bioinformatics Group
>tr|K9RXX4|K9RXX4_SYNP3 Uncharacterized protein OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312) GN=Syn6312_2841 PE=4 SV=1
MQDICLELTWYAKEGDQFIGETVLKEVDLAKLRNLLNLPPDDPISYIHPIKEAHASFLQGFTNIKIDLSEYDYFIERAV