TCDB is operated by the Saier Lab Bioinformatics Group
>KAB2930967.1 hypothetical protein F9K24_14840 [Leptonema illini]
MNLTLSVNAIVAVAQIAMAIGIAHFWWKWFRTEHKEPWLPVGYVEHERVFVYPDSVMSVLMVISAVLLLLGHPLGERLTQ
ICGGMMIFLSVIDTAYFYQHGMFRKDRNGLENWGLVLPMYVMSALMTIPFLL