TCDB is operated by the Saier Lab Bioinformatics Group
>KKK45629.1 hypothetical protein Lokiarch_08310 [Lokiarchaeum sp. GC14_75]
MSFEGTSLKWSKYEKFVSEFGKWAWILGILSGIINLIWGLYTIITLASLPSGLGIYAMDASIWLILSGIFAILISYLIIK
PKFSEKCAIQDWSFLLENWIILLGNFRFPWMLFWGIIMCIFGYGWGGIPILIPSILLLFAGPIKFEWSTKG